PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 400aa    MW: 43029.1 Da    PI: 8.8359
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008616genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.71.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+ +W+++++  g+ R+ k+c++rw +yl
      Lus10008616 14 KGPWTPEEDITLVSYIQEHGPSNWRSVPSNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding482.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10008616  67 RGDFTPHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.406961IPR017930Myb domain
SuperFamilySSF466895.99E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002492.0E-151461IPR001005SANT/Myb domain
CDDcd001677.62E-111661No hitNo description
PROSITE profilePS5129423.65362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2565117IPR009057Homeodomain-like
SMARTSM007173.9E-1566114IPR001005SANT/Myb domain
PfamPF002495.8E-1467112IPR001005SANT/Myb domain
CDDcd001671.28E-1070111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDITLVSYIQ EHGPSNWRSV PSNTGLLRCS KSCRLRWTNY  60
LRPGIKRGDF TPHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLH  120
DGGGGEGGDG GAGSPSSAAG SPQTKGQWER RLQTDIGLAK QALCEALSLD KPIQDDSSAA  180
AAAAVVMESK PLISTSPSSG SGATTSISNA ASYASSADNI ARLLQNWMRK PAHNYDQLQM  240
QTNSGTTQNS VAAVAAANSG SSGGGSHNSY FDSLFGFNSS PSDGGTSQSV EEAAAIFQDE  300
SKPMIIRQRR GNCSDDINPA TGETVSPPGP ALSLLGRWLF DESTAREPSG GCGCSCFRRR  360
RRGSHEHLVP RRCRFGFWDE LVMNTLIKSH PISVIIISQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-25141164105C-Myb DNA-Binding Domain
1mse_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239949.11e-122PREDICTED: myb-related protein 306-like
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLM5WUN21e-121M5WUN2_PRUPE; Uncharacterized protein
STRINGSolyc03g116100.2.11e-113(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.26e-88myb domain protein 96